PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G129900.1.p
Common NameGLYMA_06G129900, LOC102667394
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 255aa    MW: 29106.6 Da    PI: 6.6202
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G129900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.63.4e-25147194552
               RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          +++e++skyF  pi++AAk+++v++T+LK++CR+++I+RWP+Rkiksl
  Glyma.06G129900.1.p 147 LEFEEISKYFGVPINEAAKQMNVGVTMLKKRCRELNIMRWPRRKIKSL 194
                          89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.984130215IPR003035RWP-RK domain
PfamPF020423.9E-22147194IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MDFVFVSDND FPNLDIIPHT LNNSCFCSPH LNDTHKIMEI SPLKGYFSHL DWTPQSPYPS  60
NELPDLESWN LDFILPPLDE DLEELDQKQL KSVVPQGFHC NQEKGFGDAL LATENVSATC  120
VKKEKVQIID QSPLASSSST KKRPCALEFE EISKYFGVPI NEAAKQMNVG VTMLKKRCRE  180
LNIMRWPRRK IKSLQMVIDS VKEMGLEDEV ARLEEHKKLL EKLPGLELSE EAKKLRHACF  240
KANYKKKRCM ALQA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006581652.10.0PREDICTED: protein RKD4-like
TrEMBLK7KUT30.0K7KUT3_SOYBN; Uncharacterized protein
STRINGGLYMA06G13530.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.15e-28RWP-RK domain-containing protein